Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pSH424-ssr Resource Report Resource Website |
RRID:Addgene_198026 | T0 terminator - Sm resistance cassette | Synthetic | Streptomycin | PMID:37798358 | Backbone Size:4948; Vector Backbone:pSH624-ssr; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2023-10-12 01:04:43 | 0 | ||
|
HE_50 Resource Report Resource Website |
RRID:Addgene_201049 | n/a | Streptomycin | PMID: | This strain has 572 genetic changes compared to the DH10B reference genome in Genbank (CP000948.1). Please see https://www.ncbi.nlm.nih.gov/nuccore/CP110017 and the accompanying paper for more details. | Vector Backbone:n/a; Vector Types:Other; Bacterial Resistance:Streptomycin | 2023-05-20 01:04:11 | 0 | ||
|
pMCRi Resource Report Resource Website |
RRID:Addgene_207524 | xylS (cured of BsaI-sites), Pm→ Sp dCas9, PEM7 →sgRNA; SmR/SpR | Streptomycin | PMID:38180826 | Vector Backbone:pSEVA448; Vector Types:Other, Pseudomonas vector; Bacterial Resistance:Streptomycin | 2024-01-30 12:16:59 | 0 | |||
|
pAblo Resource Report Resource Website |
RRID:Addgene_207528 | plasmid for adenine base editing; oriV(pRO1600/ColE1), xylS, Pm→repA, P14b→msfGFP; Pm→ ABE:SpRY, PEM7→non-specific sgRNA | Streptomycin | PMID:38180826 | Backbone Marker:SEVA collection; Vector Backbone:pSEVA448; Vector Types:CRISPR, Other, Pseudomonas vector; Bacterial Resistance:Streptomycin | 2024-01-30 12:05:22 | 0 | |||
|
pS44i8GH-1 Resource Report Resource Website |
RRID:Addgene_207525 | oriV(pRO1600/ColE1), xylS, Pm→repA, P14b with a translational BCD2 coupler from BG35 (53)→msfGFP; | Streptomycin | PMID:38180826 | Backbone Marker:SEVA collection; Vector Backbone:pSEVA448; Vector Types:CRISPR, Other, Pseudomonas vector; Bacterial Resistance:Streptomycin | 2024-01-30 12:17:52 | 0 | |||
|
pEditA Resource Report Resource Website |
RRID:Addgene_207531 | Plasmid for adenine base editing; oriV(pRO1600/ColE1), xylS (cured of BsaI-sites), Pm→ ABE:SpnCas9, PEM7→non-specific sgRNA | Streptomycin | PMID:38180826 | Backbone Marker:SEVA collection; Vector Backbone:pSEVA448; Vector Types:CRISPR, Other, Pseudomonas vector; Bacterial Resistance:Streptomycin | 2024-01-30 12:05:22 | 0 | |||
|
pJK_ToeRepG2_N19_trigger Resource Report Resource Website |
RRID:Addgene_132747 | ToeRepG2_N19_trigger | Other | Streptomycin | PMID:31686032 | Please visit https://www.biorxiv.org/content/10.1101/501783v1 for bioRxiv preprint. | Backbone Size:3331; Vector Backbone:pCDFduet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2024-02-21 12:02:11 | 0 | |
|
pJK_ToeRepG2_N64_trigger Resource Report Resource Website |
RRID:Addgene_132746 | ToeRepG2_N64_trigger | Other | Streptomycin | PMID:31686032 | Please visit https://www.biorxiv.org/content/10.1101/501783v1 for bioRxiv preprint. | Backbone Size:3331; Vector Backbone:pCDFduet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2024-02-21 12:02:11 | 0 | |
|
pJK_ToeRepG2_N02_trigger Resource Report Resource Website |
RRID:Addgene_132745 | ToeRepG2_N02_trigger | Other | Streptomycin | PMID:31686032 | Please visit https://www.biorxiv.org/content/10.1101/501783v1 for bioRxiv preprint. | Backbone Size:3331; Vector Backbone:pCDFduet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2024-02-21 12:02:11 | 0 | |
|
pAG_ToeRep_N09_trigger Resource Report Resource Website |
RRID:Addgene_132740 | ToeRep_N09_trigger | Other | Streptomycin | PMID:31686032 | Please visit https://www.biorxiv.org/content/10.1101/501783v1 for bioRxiv preprint. | Backbone Size:3331; Vector Backbone:pCDFduet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2024-02-21 12:02:10 | 0 | |
|
pRAW-460 Resource Report Resource Website |
RRID:Addgene_200216 | PaCas1, PaCas2-3 | Other | Streptomycin | PMID:37710013 | Backbone Size:2819; Vector Backbone:2S; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Cas2 R55E-N56D mutations | 2023-12-16 12:04:55 | 0 | |
|
pRAW-461 Resource Report Resource Website |
RRID:Addgene_200217 | PaCas1, PaCas2-3 | Other | Streptomycin | PMID:37710013 | Backbone Size:2819; Vector Backbone:2S; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Cas2 K11D-R12E mutations | 2023-12-16 12:04:55 | 0 | |
|
pRAW-462 Resource Report Resource Website |
RRID:Addgene_200218 | PaCas1, PaCas2-3 | Other | Streptomycin | PMID:37710013 | Backbone Size:2819; Vector Backbone:2S; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Cas2 K11D-R12E, R55E-N56D mutations | 2023-12-16 12:04:55 | 0 | |
|
pCas3-Sm Resource Report Resource Website |
RRID:Addgene_208001 | RhaR | Streptomycin | PMID:37975669 | Please visit https://doi.org/10.1101/2023.06.29.547033 for bioRxiv preprint. | Backbone Marker:Dongru Qiu, Hongwei D. Yu; Backbone Size:5216; Vector Backbone:pHERD30T; Vector Types:Mammalian Expression; Bacterial Resistance:Streptomycin | 2023-12-16 12:05:12 | 0 | ||
|
pQCasTns(Vch)-entry(BsaI) Resource Report Resource Website |
RRID:Addgene_190273 | VchTniQ, VchCas5/8, VchCas7, VchCas6, VchTnsABC, CRISPR(BsaI) | Other | Streptomycin | PMID:34478496 | Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | no | 2023-12-06 12:04:26 | 0 | |
|
pTdTomato-L5 Resource Report Resource Website |
RRID:Addgene_140994 | tdTomato | Other | Streptomycin | PMID:32829077 | tdTomato: Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. red fluorescent protein Shaner Nc, Campbell Re, Steinbach Pa, Giepmans Bng, Palmer Ae, Tsien Ry (2004). Nature Biotechnology, 22(12) , 1567-1572. doi: 10.1038/nbt1037. | Vector Backbone:pMV361-strep; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | 2024-02-29 12:02:23 | 0 | |
|
PCDF Bravo-PotH-OL1del Resource Report Resource Website |
RRID:Addgene_216749 | potH | Other | Streptomycin | PMID: | IPTG inducible | Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Outer loop 1 (OL1) with the sequence of [FKISLAEMARAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQ] is deleted. | 2024-08-01 01:06:53 | 0 |
|
PCDF Bravo-PotH-OL2del Resource Report Resource Website |
RRID:Addgene_216750 | potH | Other | Streptomycin | PMID: | IPTG inducible | Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is deleted. | 2024-08-01 01:06:53 | 0 |
|
PCDF Bravo-PotH-OL3/2sub Resource Report Resource Website |
RRID:Addgene_216752 | potH | Other | Streptomycin | PMID: | IPTG inducible | Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is substituted with OL3 [ELLGGPDSIMIGRVLWQEFFNNRDW]. | 2024-08-01 01:06:53 | 0 |
|
PCDF Bravo-PotH-OL3del Resource Report Resource Website |
RRID:Addgene_216751 | potH | Other | Streptomycin | PMID: | IPTG inducible | Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin | Outer loop 3 (OL3) with the sequence of [ELLGGPDSIMIGRVLWQEFFNNRDW] is deleted. | 2024-08-01 01:06:53 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.