Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Other
Genetic Insert: Hydra Zic4 promoter
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Please visit for https://www.biorxiv.org/content/10.1101/2021.12.22.473838v1 bioRxiv preprint.
Proper citation: RRID:Addgene_193006 Copy
Species: Homo sapiens
Genetic Insert: PXK-PX (1-125)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS
Proper citation: RRID:Addgene_119114 Copy
Species: Drosophila melanogaster
Genetic Insert: Polycomb
Vector Backbone Description: Backbone Size:5680; Vector Backbone:pET-11d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183781 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac Puro SRT
Vector Backbone Description: Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193159 Copy
Species: Other
Genetic Insert: Hydra Sp5
Vector Backbone Description: Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192994 Copy
Species: Danio rerio
Genetic Insert: Zebrafish Wnt3 promoter
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192992 Copy
Species: Danio rerio
Genetic Insert: Zebrafish Sp5-like
Vector Backbone Description: Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192999 Copy
Species: Other
Genetic Insert: Hydra Nematocilin A
Vector Backbone Description: Vector Backbone:pGEM-T; Vector Types:Other, cloning vector; Bacterial Resistance:Ampicillin
References:
Comments: Please visit for https://www.biorxiv.org/content/10.1101/2021.12.22.473838v1 bioRxiv preprint.
Proper citation: RRID:Addgene_193010 Copy
Species: Drosophila melanogaster
Genetic Insert: mini-white
Vector Backbone Description: Backbone Size:4300; Vector Backbone:pUAST; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
References:
Comments: pUASTP2.1 contains a P-element target for RMCE, the mini-white gene flanked by inverted attP sites. It is a derivative of PUASTP2 in which the UAS and TATA sequences flanking the cassette have been removed. (Specifically, PUASTP2 was digested with BamHI and StuI to remove UAS-TATA-attP, and an attP-containing BamHI-EcoRV fragment from pTA-attP was inserted). This vector can be used to generate target lines by standard P element transgenesis.
Proper citation: RRID:Addgene_13842 Copy
Species: Drosophila melanogaster
Genetic Insert: mini-white
Vector Backbone Description: Backbone Size:5500; Vector Backbone:pUAST; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
References:
Comments: pUASTP2 contains a P-element target for RMCE, the mini-white gene flanked by inverted attP sites. This target cassette was contructed in the parent vector pUAST. This vector can be used to generate target lines by standard P element transgenesis.
Please note that the UAS binding sites and hsp70 promoter of pUAST are outside of the exchange cassette in this vector - i.e. following RMCE, these elements will remain flanking the cassette.
Proper citation: RRID:Addgene_13843 Copy
Species: Homo sapiens
Genetic Insert: NEDD4-2 WW2 domain and human phosphopeptides fused to split mCherry
Vector Backbone Description: Vector Backbone:pNAS derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111708 Copy
Species: Homo sapiens
Genetic Insert: 14-3-3σ and human phosphopeptides fused to split mCherry
Vector Backbone Description: Vector Backbone:pNAS derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_111706 Copy
Species: Other
Genetic Insert: dCas9N-IntN
Vector Backbone Description: Backbone Size:4670; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_165450 Copy
Species: Other
Genetic Insert: CAHS8
Vector Backbone Description: Backbone Marker:Modified from pET-22b(+) [Park J-M, et al (2002) Biochem Biophys Res Commun 291, 23-28.]; Backbone Size:6128; Vector Backbone:pEThT; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192467 Copy
Species: Other
Genetic Insert: CAHS3
Vector Backbone Description: Backbone Marker:Modified from pET-22b(+) [Park J-M, et al (2002) Biochem Biophys Res Commun 291, 23-28.]; Backbone Size:6128; Vector Backbone:pEThT; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192466 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac Puro SRT
Vector Backbone Description: Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193157 Copy
Species: Other
Genetic Insert: IntC-dCas9C-VPR
Vector Backbone Description: Backbone Size:3530; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_166692 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac Puro SRT
Vector Backbone Description: Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193154 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac Puro SRT
Vector Backbone Description: Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193151 Copy
Species: Drosophila melanogaster
Genetic Insert: Asunder
Vector Backbone Description: Vector Backbone:CS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_47041 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
