Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Bacterial Resistance:ampicillin (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

295,500 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
Zic4-3505-D4:Luc
 
Resource Report
Resource Website
RRID:Addgene_193006 Hydra Zic4 promoter Other Ampicillin PMID: Please visit for https://www.biorxiv.org/content/10.1101/2021.12.22.473838v1 bioRxiv preprint. Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin partial deletion of the Hydra Zic4 promoter-D4 2022-12-04 12:04:11 0
PXK-PX (1-125)
 
Resource Report
Resource Website
RRID:Addgene_119114 PXK-PX (1-125) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2022-12-04 12:01:07 0
pET11-PC(75-390)-H6
 
Resource Report
Resource Website
RRID:Addgene_183781 Polycomb Drosophila melanogaster Ampicillin PMID:26802126 Backbone Size:5680; Vector Backbone:pET-11d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 6 His tag at the C-terminus 2022-12-04 12:03:56 0
PB-SRT-Puro_BC17
 
Resource Report
Resource Website
RRID:Addgene_193159 Barcoded piggyBac Puro SRT Homo sapiens Ampicillin PMID:36062164 Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Barcode: TGGT 2022-12-04 12:04:11 0
HySp5-337
 
Resource Report
Resource Website
RRID:Addgene_192994 Hydra Sp5 Other Ampicillin PMID:30659200 Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin no DNA binding domain 2022-12-04 12:04:11 0
ZfWnt3:Luc
 
Resource Report
Resource Website
RRID:Addgene_192992 Zebrafish Wnt3 promoter Danio rerio Ampicillin PMID:30659200 Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2022-12-04 12:04:11 0
ZfSp5l1
 
Resource Report
Resource Website
RRID:Addgene_192999 Zebrafish Sp5-like Danio rerio Ampicillin PMID:30659200 Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2022-12-04 12:04:11 0
pGEM-T-Easy-NematocilinA
 
Resource Report
Resource Website
RRID:Addgene_193010 Hydra Nematocilin A Other Ampicillin PMID: Please visit for https://www.biorxiv.org/content/10.1101/2021.12.22.473838v1 bioRxiv preprint. Vector Backbone:pGEM-T; Vector Types:Other, cloning vector; Bacterial Resistance:Ampicillin 2022-12-04 12:04:11 0
pUASTP2.1
 
Resource Report
Resource Website
RRID:Addgene_13842 mini-white Drosophila melanogaster Ampicillin PMID:16547094 pUASTP2.1 contains a P-element target for RMCE, the mini-white gene flanked by inverted attP sites. It is a derivative of PUASTP2 in which the UAS and TATA sequences flanking the cassette have been removed. (Specifically, PUASTP2 was digested with BamHI and StuI to remove UAS-TATA-attP, and an attP-containing BamHI-EcoRV fragment from pTA-attP was inserted). This vector can be used to generate target lines by standard P element transgenesis. Backbone Size:4300; Vector Backbone:pUAST; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin 2022-12-04 12:02:08 0
pUASTP2
 
Resource Report
Resource Website
RRID:Addgene_13843 mini-white Drosophila melanogaster Ampicillin PMID:16547094 pUASTP2 contains a P-element target for RMCE, the mini-white gene flanked by inverted attP sites. This target cassette was contructed in the parent vector pUAST. This vector can be used to generate target lines by standard P element transgenesis. Please note that the UAS binding sites and hsp70 promoter of pUAST are outside of the exchange cassette in this vector - i.e. following RMCE, these elements will remain flanking the cassette. Backbone Size:5500; Vector Backbone:pUAST; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin 2022-12-04 12:02:08 0
Mode #2 Library (NEDD4-2 WW2 domain)
 
Resource Report
Resource Website
RRID:Addgene_111708 NEDD4-2 WW2 domain and human phosphopeptides fused to split mCherry Homo sapiens Ampicillin PMID:29889213 Vector Backbone:pNAS derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2022-12-03 12:00:44 0
Mode #2 Library (14-3-3σ)
 
Resource Report
Resource Website
RRID:Addgene_111706 14-3-3σ and human phosphopeptides fused to split mCherry Homo sapiens Ampicillin PMID:29889213 Vector Backbone:pNAS derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2022-12-03 12:00:44 0
pAAV-3xsgRNA_Opn1mw-RHO-Cas9N-IntN-polyA
 
Resource Report
Resource Website
RRID:Addgene_165450 dCas9N-IntN Other Ampicillin PMID:32875106 Backbone Size:4670; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin 2022-12-03 12:03:09 0
pEThT-RvCAHS8
 
Resource Report
Resource Website
RRID:Addgene_192467 CAHS8 Other Ampicillin PMID:36067153 Backbone Marker:Modified from pET-22b(+) [Park J-M, et al (2002) Biochem Biophys Res Commun 291, 23-28.]; Backbone Size:6128; Vector Backbone:pEThT; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2022-12-03 12:04:17 0
pEThT-RvCAHS3
 
Resource Report
Resource Website
RRID:Addgene_192466 CAHS3 Other Ampicillin PMID:36067153 Backbone Marker:Modified from pET-22b(+) [Park J-M, et al (2002) Biochem Biophys Res Commun 291, 23-28.]; Backbone Size:6128; Vector Backbone:pEThT; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2022-12-03 12:04:17 0
PB-SRT-Puro_BC15
 
Resource Report
Resource Website
RRID:Addgene_193157 Barcoded piggyBac Puro SRT Homo sapiens Ampicillin PMID:36062164 Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Barcode: GTGT 2022-12-03 12:04:18 0
pAAV-RHO-IntC-dCas9C-VPR-polyA
 
Resource Report
Resource Website
RRID:Addgene_166692 IntC-dCas9C-VPR Other Ampicillin PMID:32875106 Backbone Size:3530; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin 2022-12-03 12:03:12 0
PB-SRT-Puro_BC12
 
Resource Report
Resource Website
RRID:Addgene_193154 Barcoded piggyBac Puro SRT Homo sapiens Ampicillin PMID:36062164 Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Barcode: CTTC 2022-12-03 12:04:18 0
PB-SRT-Puro_BC9
 
Resource Report
Resource Website
RRID:Addgene_193151 Barcoded piggyBac Puro SRT Homo sapiens Ampicillin PMID:36062164 Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Barcode: TCGA 2022-12-03 12:04:18 0
CS2-HA-dASUN
 
Resource Report
Resource Website
RRID:Addgene_47041 Asunder Drosophila melanogaster Ampicillin PMID:23097494 Vector Backbone:CS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2022-12-03 12:05:29 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.