Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
Zic4-3505-D4:Luc Resource Report Resource Website |
RRID:Addgene_193006 | Hydra Zic4 promoter | Other | Ampicillin | PMID: | Please visit for https://www.biorxiv.org/content/10.1101/2021.12.22.473838v1 bioRxiv preprint. | Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | partial deletion of the Hydra Zic4 promoter-D4 | 2022-12-04 12:04:11 | 0 |
|
PXK-PX (1-125) Resource Report Resource Website |
RRID:Addgene_119114 | PXK-PX (1-125) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2022-12-04 12:01:07 | 0 | |
|
pET11-PC(75-390)-H6 Resource Report Resource Website |
RRID:Addgene_183781 | Polycomb | Drosophila melanogaster | Ampicillin | PMID:26802126 | Backbone Size:5680; Vector Backbone:pET-11d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 6 His tag at the C-terminus | 2022-12-04 12:03:56 | 0 | |
|
PB-SRT-Puro_BC17 Resource Report Resource Website |
RRID:Addgene_193159 | Barcoded piggyBac Puro SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Barcode: TGGT | 2022-12-04 12:04:11 | 0 | |
|
HySp5-337 Resource Report Resource Website |
RRID:Addgene_192994 | Hydra Sp5 | Other | Ampicillin | PMID:30659200 | Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | no DNA binding domain | 2022-12-04 12:04:11 | 0 | |
|
ZfWnt3:Luc Resource Report Resource Website |
RRID:Addgene_192992 | Zebrafish Wnt3 promoter | Danio rerio | Ampicillin | PMID:30659200 | Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-04 12:04:11 | 0 | ||
|
ZfSp5l1 Resource Report Resource Website |
RRID:Addgene_192999 | Zebrafish Sp5-like | Danio rerio | Ampicillin | PMID:30659200 | Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-04 12:04:11 | 0 | ||
|
pGEM-T-Easy-NematocilinA Resource Report Resource Website |
RRID:Addgene_193010 | Hydra Nematocilin A | Other | Ampicillin | PMID: | Please visit for https://www.biorxiv.org/content/10.1101/2021.12.22.473838v1 bioRxiv preprint. | Vector Backbone:pGEM-T; Vector Types:Other, cloning vector; Bacterial Resistance:Ampicillin | 2022-12-04 12:04:11 | 0 | |
|
pUASTP2.1 Resource Report Resource Website |
RRID:Addgene_13842 | mini-white | Drosophila melanogaster | Ampicillin | PMID:16547094 | pUASTP2.1 contains a P-element target for RMCE, the mini-white gene flanked by inverted attP sites. It is a derivative of PUASTP2 in which the UAS and TATA sequences flanking the cassette have been removed. (Specifically, PUASTP2 was digested with BamHI and StuI to remove UAS-TATA-attP, and an attP-containing BamHI-EcoRV fragment from pTA-attP was inserted). This vector can be used to generate target lines by standard P element transgenesis. | Backbone Size:4300; Vector Backbone:pUAST; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2022-12-04 12:02:08 | 0 | |
|
pUASTP2 Resource Report Resource Website |
RRID:Addgene_13843 | mini-white | Drosophila melanogaster | Ampicillin | PMID:16547094 | pUASTP2 contains a P-element target for RMCE, the mini-white gene flanked by inverted attP sites. This target cassette was contructed in the parent vector pUAST. This vector can be used to generate target lines by standard P element transgenesis. Please note that the UAS binding sites and hsp70 promoter of pUAST are outside of the exchange cassette in this vector - i.e. following RMCE, these elements will remain flanking the cassette. | Backbone Size:5500; Vector Backbone:pUAST; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin | 2022-12-04 12:02:08 | 0 | |
|
Mode #2 Library (NEDD4-2 WW2 domain) Resource Report Resource Website |
RRID:Addgene_111708 | NEDD4-2 WW2 domain and human phosphopeptides fused to split mCherry | Homo sapiens | Ampicillin | PMID:29889213 | Vector Backbone:pNAS derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2022-12-03 12:00:44 | 0 | ||
|
Mode #2 Library (14-3-3σ) Resource Report Resource Website |
RRID:Addgene_111706 | 14-3-3σ and human phosphopeptides fused to split mCherry | Homo sapiens | Ampicillin | PMID:29889213 | Vector Backbone:pNAS derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2022-12-03 12:00:44 | 0 | ||
|
pAAV-3xsgRNA_Opn1mw-RHO-Cas9N-IntN-polyA Resource Report Resource Website |
RRID:Addgene_165450 | dCas9N-IntN | Other | Ampicillin | PMID:32875106 | Backbone Size:4670; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin | 2022-12-03 12:03:09 | 0 | ||
|
pEThT-RvCAHS8 Resource Report Resource Website |
RRID:Addgene_192467 | CAHS8 | Other | Ampicillin | PMID:36067153 | Backbone Marker:Modified from pET-22b(+) [Park J-M, et al (2002) Biochem Biophys Res Commun 291, 23-28.]; Backbone Size:6128; Vector Backbone:pEThT; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2022-12-03 12:04:17 | 0 | ||
|
pEThT-RvCAHS3 Resource Report Resource Website |
RRID:Addgene_192466 | CAHS3 | Other | Ampicillin | PMID:36067153 | Backbone Marker:Modified from pET-22b(+) [Park J-M, et al (2002) Biochem Biophys Res Commun 291, 23-28.]; Backbone Size:6128; Vector Backbone:pEThT; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2022-12-03 12:04:17 | 0 | ||
|
PB-SRT-Puro_BC15 Resource Report Resource Website |
RRID:Addgene_193157 | Barcoded piggyBac Puro SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Barcode: GTGT | 2022-12-03 12:04:18 | 0 | |
|
pAAV-RHO-IntC-dCas9C-VPR-polyA Resource Report Resource Website |
RRID:Addgene_166692 | IntC-dCas9C-VPR | Other | Ampicillin | PMID:32875106 | Backbone Size:3530; Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin | 2022-12-03 12:03:12 | 0 | ||
|
PB-SRT-Puro_BC12 Resource Report Resource Website |
RRID:Addgene_193154 | Barcoded piggyBac Puro SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Barcode: CTTC | 2022-12-03 12:04:18 | 0 | |
|
PB-SRT-Puro_BC9 Resource Report Resource Website |
RRID:Addgene_193151 | Barcoded piggyBac Puro SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Barcode: TCGA | 2022-12-03 12:04:18 | 0 | |
|
CS2-HA-dASUN Resource Report Resource Website |
RRID:Addgene_47041 | Asunder | Drosophila melanogaster | Ampicillin | PMID:23097494 | Vector Backbone:CS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-03 12:05:29 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.