Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: ARFRP1
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pET-DEST42; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67429 Copy
Species: Homo sapiens
Genetic Insert: ARL14
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pET-DEST42; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67427 Copy
Species: Homo sapiens
Genetic Insert: ARL14
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pDEST14; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67385 Copy
Species: Homo sapiens
Genetic Insert: ARL8B
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pDEST14; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67383 Copy
Species: Homo sapiens
Genetic Insert: ARL7
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pDEST14; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67381 Copy
Species: Homo sapiens
Genetic Insert: ARL8B
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pET-DEST42; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67425 Copy
Species: Homo sapiens
Genetic Insert: ARL7
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pET-DEST42; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67423 Copy
Species: Homo sapiens
Genetic Insert: SARA
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pDEST14; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67389 Copy
Species: Homo sapiens
Genetic Insert: ARL6
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pET-DEST42; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67422 Copy
Species: Homo sapiens
Genetic Insert: ARFRP1
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pDEST14; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_67387 Copy
Species: Mus musculus
Genetic Insert: SSeCKs
Vector Backbone Description: Backbone Size:5198; Vector Backbone:pBABE; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_106908 Copy
Species: Mus musculus
Genetic Insert: CCAAT enhancer binding protein gamma
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5427; Vector Backbone:pcDNA3.1(-); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_12560 Copy
Species:
Genetic Insert: Tn5
Vector Backbone Description: Backbone Size:5260; Vector Backbone:pET-45b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_112112 Copy
Species: Homo sapiens
Genetic Insert: HXK1
Vector Backbone Description: Backbone Marker:Markku Varjosalo, Addgene plasmid #108077; Vector Backbone:MAC-tag-C; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: CCSB-DFCI hORFeome collection(11025_D02)
Proper citation: RRID:Addgene_111668 Copy
Species: Homo sapiens
Genetic Insert: KLF8
Vector Backbone Description: Backbone Size:9514; Vector Backbone:Unknown; Vector Types:Lentiviral; Bacterial Resistance:Ampicillin
References:
Comments: 5' cloning site: BamHI (not destroyed), 3' cloning site: BamHI (not destroyed).
Proper citation: RRID:Addgene_120494 Copy
Species: Homo sapiens
Genetic Insert: hTRIM28
Vector Backbone Description: Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_124958 Copy
Species: Mus musculus
Genetic Insert: pgk-1 5' and 3' regions
Vector Backbone Description: Backbone Size:2700; Vector Backbone:pUC18; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: Includes 500 bp mouse PGK promoter, 832 bp neo, 460 bp PGK 3' end.
Proper citation: RRID:Addgene_11333 Copy
Species: Homo sapiens
Genetic Insert: SNX8-PX (70-190)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: Amino Acid Sequence: ELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESA
Proper citation: RRID:Addgene_119089 Copy
Species: Mus musculus
Genetic Insert: SSeCKs T751A
Vector Backbone Description: Backbone Size:5198; Vector Backbone:pBABE; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_107142 Copy
Species: Mus musculus
Genetic Insert: anti-Malin (Homo sapiens) recombinant mouse monoclonal antibody
Vector Backbone Description: Backbone Marker:Yves Durocher, NRC; Backbone Size:5925; Vector Backbone:P1316-IgG2a; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: RRID: AB_2750818. Isotype: IgG2a. Additional species: human.
A portion of this plasmid was derived from a plasmid, pTT3, which was obtained from Yves Durocher, National Research Council of Canada- Biotechnology Research Institute.
Proper citation: RRID:Addgene_114513 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.