Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Arabidopsis thaliana
Genetic Insert: Phytochrome B
Vector Backbone Description: Backbone Marker:Junichi Miyazaki (Osaka University, Japan); Backbone Size:4870; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Expression vector of PhyB-mCherry-HRasCT in mammalian cells. Of note, the expression level of PIF3-mEGFP must be comparable or lower than that of PhyB. We usually co-transfect pCAGGS-PhyB-mCherry-HRasCT and pCAGGS-PIF3-mEGFP plasmids into HeLa cells with lipofection in a 50:1 ratio.
mCherry has a G229L mutation that does not affect function.
Proper citation: RRID:Addgene_100281 Copy
Species: Other
Genetic Insert: MTS-PcyA-FLAG-P2A-MTS-HA-HO1-P2A-MTS-Myc-Fd-P2A-MTS-Fnr-T7 (synthetic genes)
Vector Backbone Description: Backbone Marker:Junichi Miyazaki (Osaka University, Japan); Backbone Size:4870; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Expression vector for Phycocyanobilin (PCB) synthesis in mammalian cells.
Proper citation: RRID:Addgene_100280 Copy
Species: Other
Genetic Insert: MTS-PcyA-FLAG-P2A-MTS-HA-HO1-P2A-MTS-Myc-Fd-P2A-MTS-Fnr-T7 (synthetic genes)
Vector Backbone Description: Backbone Marker:Junichi Miyazaki (Osaka University, Japan); Backbone Size:4870; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Expression vector for Phycocyanobilin (PCB) synthesis in mammalian cells. In addition, shRNA targeting to mouse BVRA is expressed so that PCB is further accumulated.
Proper citation: RRID:Addgene_100286 Copy
Species: Other
Genetic Insert: MTS-PcyA-FLAG-P2A-MTS-HA-HO1-P2A-MTS-Myc-Fd-P2A-MTS-Fnr-T7 (synthetic genes)
Vector Backbone Description: Backbone Marker:Junichi Miyazaki (Osaka University, Japan); Backbone Size:4870; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Expression vector for Phycocyanobilin (PCB) synthesis in mammalian cells. In addition, shRNA targeting to human BVRA is expressed so that PCB is further accumulated.
Proper citation: RRID:Addgene_100285 Copy
Species: Other
Genetic Insert: GGPP synthase
Vector Backbone Description: Backbone Size:4846; Vector Backbone:pLM304; Vector Types:Yeast Expression, Cre/Lox, Synthetic Biology; Bacterial Resistance:Ampicillin
References:
Comments: Addgene NGS sequencing found the following mutations compared to the provided reference sequence: crtE with M176I, K346R, I347M, E353D mutations, crtI with L107F, H427Q mutations, and crtYB with A190T, E307K mutations. tHMG1 contains only residues 531-1054 compared to the NCBI reference seq [M22002.1]. These mutations/truncation do not affect plasmid function.
Proper citation: RRID:Addgene_100539 Copy
Species: Arabidopsis thaliana
Genetic Insert: Phytochrome B
Vector Backbone Description: Backbone Size:4885; Vector Backbone:pL1A0*B0*_Leu; Vector Types:Yeast Expression, Cre/Lox, Synthetic Biology; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100537 Copy
Species: Other
Genetic Insert: Floxed TgDHFR-TS*
Vector Backbone Description: Backbone Size:2678; Vector Backbone:pUC19; Vector Types:Other, Toxoplasma expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100605 Copy
Species: Other
Genetic Insert: N-terminal Flag and biotin-acceptor-site (FB)-tagged dCas9
Vector Backbone Description: Backbone Size:7064; Vector Backbone:pEF1a-FB-puro; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100547 Copy
Species: Homo sapiens
Genetic Insert: thymidine kinase 1
Vector Backbone Description: Backbone Marker:invitrogen; Backbone Size:5428; Vector Backbone:pCDNA3.1+; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100544 Copy
Species:
Genetic Insert: ciCas9(F22)
Vector Backbone Description: Backbone Marker:Life Technology; Vector Backbone:pcDNA5/FRT/TO; Vector Types:Mammalian Expression, CRISPR, Other, FRT, Flp-In; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100552 Copy
Species:
Genetic Insert: ciCas9(L22)
Vector Backbone Description: Backbone Marker:Life Technology; Vector Backbone:pcDNA5/FRT/TO; Vector Types:Mammalian Expression, CRISPR, Other, FRT, Flp-In; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100551 Copy
Species: Homo sapiens
Genetic Insert: Promoter Reporter Insert within donor template
Vector Backbone Description: Backbone Marker:Manuel A.F.V. Goncalves; Vector Backbone:AY10_pS.Donor.R5.TS; Vector Types:CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192272 Copy
Species: Homo sapiens
Genetic Insert: PRDM14
Vector Backbone Description: Vector Backbone:pMSCV puro; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193678 Copy
Species: Mus musculus
Genetic Insert: HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Predicted peptide sequences for 1D3 Heavy Chain:
MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK*
Proper citation: RRID:Addgene_170670 Copy
Species: Mus musculus
Genetic Insert: LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Predicted peptide sequences for 1D3 Light Chain:
MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC*
Proper citation: RRID:Addgene_170669 Copy
Species: Homo sapiens
Genetic Insert: Noa1-HIS
Vector Backbone Description: Vector Backbone:pEXP1-DEST; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_191972 Copy
Species: Homo sapiens
Genetic Insert: IFNGR1
Vector Backbone Description: Backbone Marker:Covalys, NEB; Backbone Size:5787; Vector Backbone:pSEMS(26m); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192786 Copy
Species: Homo sapiens
Genetic Insert: IFNAR1
Vector Backbone Description: Backbone Marker:Covalys, NEB; Backbone Size:5787; Vector Backbone:pSEMS(26m); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192784 Copy
Species: Other
Genetic Insert: antiGFP nanobody enhancer
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5443; Vector Backbone:pet21a (+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: Reference to anti-GFP nanobody enhancer:
Kirchhofer A, Helma J, Schmidthals K, Frauer C, Cui S, Karcher A, Pellis M, Muyldermans S, Casas-Delucchi CS, Cardoso MC, Leonhardt H, Hopfner KP, Rothbauer U. Modulation of protein properties in living cells using nanobodies. Nat Struct Mol Biol. 2010 Jan;17(1):133-8. doi: 10.1038/nsmb.1727. Epub 2009 Dec 13. PMID: 20010839.
Proper citation: RRID:Addgene_192788 Copy
Species: Homo sapiens
Genetic Insert: sgRNA targeting alpha satellites on human chromosome 9
Vector Backbone Description: Backbone Size:7100; Vector Backbone:pSIN-U6-tracer_sgRNA_-EF1a-Thy1.1-P2A-Neo; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_191397 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
