Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pCAGGS-hPhyB-mCherry-HRasCT Resource Report Resource Website |
RRID:Addgene_100281 | Phytochrome B | Arabidopsis thaliana | Ampicillin | PMID:29078307 | Expression vector of PhyB-mCherry-HRasCT in mammalian cells. Of note, the expression level of PIF3-mEGFP must be comparable or lower than that of PhyB. We usually co-transfect pCAGGS-PhyB-mCherry-HRasCT and pCAGGS-PIF3-mEGFP plasmids into HeLa cells with lipofection in a 50:1 ratio. mCherry has a G229L mutation that does not affect function. | Backbone Marker:Junichi Miyazaki (Osaka University, Japan); Backbone Size:4870; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Human codon optimized PhyB (1-908 aa) | 2022-04-22 03:14:48 | 0 |
|
pCAGGS-PHFF Resource Report Resource Website |
RRID:Addgene_100280 | MTS-PcyA-FLAG-P2A-MTS-HA-HO1-P2A-MTS-Myc-Fd-P2A-MTS-Fnr-T7 (synthetic genes) | Other | Ampicillin | PMID:29078307 | Expression vector for Phycocyanobilin (PCB) synthesis in mammalian cells. | Backbone Marker:Junichi Miyazaki (Osaka University, Japan); Backbone Size:4870; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | All genes are codon-optimized for expression in human cells. | 2022-04-22 03:14:48 | 0 |
|
pCAGGS-PHFF-sh-mBVRA Resource Report Resource Website |
RRID:Addgene_100286 | MTS-PcyA-FLAG-P2A-MTS-HA-HO1-P2A-MTS-Myc-Fd-P2A-MTS-Fnr-T7 (synthetic genes) | Other | Ampicillin | PMID:29078307 | Expression vector for Phycocyanobilin (PCB) synthesis in mammalian cells. In addition, shRNA targeting to mouse BVRA is expressed so that PCB is further accumulated. | Backbone Marker:Junichi Miyazaki (Osaka University, Japan); Backbone Size:4870; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | All genes are codon-optimized for expression in human cells. | 2022-04-22 03:14:49 | 0 |
|
pCAGGS-PHFF-sh-hBVRA Resource Report Resource Website |
RRID:Addgene_100285 | MTS-PcyA-FLAG-P2A-MTS-HA-HO1-P2A-MTS-Myc-Fd-P2A-MTS-Fnr-T7 (synthetic genes) | Other | Ampicillin | PMID:29078307 | Expression vector for Phycocyanobilin (PCB) synthesis in mammalian cells. In addition, shRNA targeting to human BVRA is expressed so that PCB is further accumulated. | Backbone Marker:Junichi Miyazaki (Osaka University, Japan); Backbone Size:4870; Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | All genes are codon-optimized for expression in human cells. | 2022-04-22 03:14:49 | 0 |
|
pLM494 Resource Report Resource Website |
RRID:Addgene_100539 | GGPP synthase | Other | Ampicillin | PMID:29789561 | Addgene NGS sequencing found the following mutations compared to the provided reference sequence: crtE with M176I, K346R, I347M, E353D mutations, crtI with L107F, H427Q mutations, and crtYB with A190T, E307K mutations. tHMG1 contains only residues 531-1054 compared to the NCBI reference seq [M22002.1]. These mutations/truncation do not affect plasmid function. | Backbone Size:4846; Vector Backbone:pLM304; Vector Types:Yeast Expression, Cre/Lox, Synthetic Biology; Bacterial Resistance:Ampicillin | 2022-04-22 03:14:52 | 0 | |
|
pLH_Scr15 Resource Report Resource Website |
RRID:Addgene_100537 | Phytochrome B | Arabidopsis thaliana | Ampicillin | PMID:29789561 | Backbone Size:4885; Vector Backbone:pL1A0*B0*_Leu; Vector Types:Yeast Expression, Cre/Lox, Synthetic Biology; Bacterial Resistance:Ampicillin | N-terminal version of PhyB (AA 1-621)/ Mutation of nucleotide 576 C-->A | 2022-04-22 03:14:52 | 0 | |
|
pFloxed DHFR-TS* Resource Report Resource Website |
RRID:Addgene_100605 | Floxed TgDHFR-TS* | Other | Ampicillin | PMID: | Backbone Size:2678; Vector Backbone:pUC19; Vector Types:Other, Toxoplasma expression; Bacterial Resistance:Ampicillin | Pyrimethamine resistance | 2022-04-22 03:14:53 | 0 | |
|
pEF1a-FB-dCas9-puro Resource Report Resource Website 1+ mentions |
RRID:Addgene_100547 | N-terminal Flag and biotin-acceptor-site (FB)-tagged dCas9 | Other | Ampicillin | PMID:28841410 | Backbone Size:7064; Vector Backbone:pEF1a-FB-puro; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | 2022-04-22 03:14:52 | 1 | ||
|
pcDNA3.1-TK1 Resource Report Resource Website |
RRID:Addgene_100544 | thymidine kinase 1 | Homo sapiens | Ampicillin | PMID:29100421 | Backbone Marker:invitrogen; Backbone Size:5428; Vector Backbone:pCDNA3.1+; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-04-22 03:14:52 | 0 | ||
|
ciCas9(F22)_pcDNA5 Resource Report Resource Website |
RRID:Addgene_100552 | ciCas9(F22) | Ampicillin | PMID:28737741 | Backbone Marker:Life Technology; Vector Backbone:pcDNA5/FRT/TO; Vector Types:Mammalian Expression, CRISPR, Other, FRT, Flp-In; Bacterial Resistance:Ampicillin | 2022-04-22 03:14:52 | 0 | |||
|
ciCas9(L22)_pcDNA5 Resource Report Resource Website |
RRID:Addgene_100551 | ciCas9(L22) | Ampicillin | PMID:28737741 | Backbone Marker:Life Technology; Vector Backbone:pcDNA5/FRT/TO; Vector Types:Mammalian Expression, CRISPR, Other, FRT, Flp-In; Bacterial Resistance:Ampicillin | 2022-04-22 03:14:52 | 0 | |||
|
TERTp146_Gluc_CCR5 Resource Report Resource Website |
RRID:Addgene_192272 | Promoter Reporter Insert within donor template | Homo sapiens | Ampicillin | PMID:34010660 | Backbone Marker:Manuel A.F.V. Goncalves; Vector Backbone:AY10_pS.Donor.R5.TS; Vector Types:CRISPR; Bacterial Resistance:Ampicillin | -146 C to T | 2022-12-22 03:25:31 | 0 | |
|
pMSCV puro PRDM14 ΔSET+ΔZinc finger domains Resource Report Resource Website |
RRID:Addgene_193678 | PRDM14 | Homo sapiens | Ampicillin | PMID:34990589 | Vector Backbone:pMSCV puro; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | Deletion of SET and Zinc finger domains | 2022-12-22 03:26:00 | 0 | |
|
1D3 HC Resource Report Resource Website |
RRID:Addgene_170670 | HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody | Mus musculus | Ampicillin | PMID:36378644 | Predicted peptide sequences for 1D3 Heavy Chain: MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK* | Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:19 | 0 | |
|
1D3 LC Resource Report Resource Website |
RRID:Addgene_170669 | LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody | Mus musculus | Ampicillin | PMID:36378644 | Predicted peptide sequences for 1D3 Light Chain: MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC* | Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:19 | 0 | |
|
pEXP1-DEST-Noa1-HIS Resource Report Resource Website |
RRID:Addgene_191972 | Noa1-HIS | Homo sapiens | Ampicillin | PMID: | Vector Backbone:pEXP1-DEST; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin | 2022-12-22 02:16:00 | 0 | ||
|
pSems-leader-mXFPm-IFNGR1(18-489) Resource Report Resource Website |
RRID:Addgene_192786 | IFNGR1 | Homo sapiens | Ampicillin | PMID:35474965 | Backbone Marker:Covalys, NEB; Backbone Size:5787; Vector Backbone:pSEMS(26m); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | mXFPm: tryptophan 66 to phenylalanine, gluatmic acid 142 to asparagine and histidine 164 to asparagine | 2022-12-22 02:16:01 | 0 | |
|
pSems-leader-SNAPf-mXFPm-IFNAR1(28-557) Resource Report Resource Website |
RRID:Addgene_192784 | IFNAR1 | Homo sapiens | Ampicillin | PMID:35474965 | Backbone Marker:Covalys, NEB; Backbone Size:5787; Vector Backbone:pSEMS(26m); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | mXFPm: tryptophan 66 to phenylalanine, gluatmic acid 142 to asparagine and histidine 164 to asparagine | 2022-12-22 02:16:01 | 0 | |
|
pet21a-aGFPnb-enhancer-cys-linker-YbbR-(PAS)5-H6 Resource Report Resource Website |
RRID:Addgene_192788 | antiGFP nanobody enhancer | Other | Ampicillin | PMID:35474965 | Reference to anti-GFP nanobody enhancer: Kirchhofer A, Helma J, Schmidthals K, Frauer C, Cui S, Karcher A, Pellis M, Muyldermans S, Casas-Delucchi CS, Cardoso MC, Leonhardt H, Hopfner KP, Rothbauer U. Modulation of protein properties in living cells using nanobodies. Nat Struct Mol Biol. 2010 Jan;17(1):133-8. doi: 10.1038/nsmb.1727. Epub 2009 Dec 13. PMID: 20010839. | Backbone Marker:EMD Biosciences; Backbone Size:5443; Vector Backbone:pet21a (+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:16:01 | 0 | |
|
pSIN-U6-tracer_C9_1_-EF1a-Thy1.1-P2A-Neo Resource Report Resource Website |
RRID:Addgene_191397 | sgRNA targeting alpha satellites on human chromosome 9 | Homo sapiens | Ampicillin | PMID:28935858 | Backbone Size:7100; Vector Backbone:pSIN-U6-tracer_sgRNA_-EF1a-Thy1.1-P2A-Neo; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:59 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
