Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pFUSEss-CHIg-mM-Asn209Phe_M18 Resource Report Resource Website |
RRID:Addgene_91750 | immunoglobulin heavy constant mu | Mus musculus | Bleocin (Zeocin) | PMID:29323348 | Backbone Marker:Invivogen; Backbone Size:4852; Vector Backbone:pFUSEss-CHIg-mM; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | Asn209 changed to Phe (EU numbering) | 2023-03-31 01:09:14 | 0 | |
|
I341L Resource Report Resource Website |
RRID:Addgene_184313 | Act5C | Drosophila melanogaster | Bleocin (Zeocin) | PMID:35332323 | Insert was expressed in fusion with beta-thymosin4. Can be expressed in GS115. | Backbone Marker:Invitrogen; Backbone Size:3328; Vector Backbone:pPICZ B; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | I341L | 2023-03-31 01:05:10 | 0 |
|
pPpT4- HTA1prom-TIR1-FLAG Resource Report Resource Website |
RRID:Addgene_189725 | OsTIR1 | Bleocin (Zeocin) | PMID:36043049 | Backbone Marker:Näätsaari et al., 2012; Vector Backbone:pPpT4; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:05:25 | 0 | |||
|
pPpT4- TEF2prom-TIR1-FLAG Resource Report Resource Website |
RRID:Addgene_189726 | OsTIR1 | Bleocin (Zeocin) | PMID:36043049 | Backbone Marker:Näätsaari et al., 2012; Vector Backbone:pPpT4; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:05:25 | 0 | |||
|
pPpT4- HTA1prom-TIR1 F74G -FLAG Resource Report Resource Website |
RRID:Addgene_189728 | OsTIR1 | Bleocin (Zeocin) | PMID:36043049 | Backbone Marker:Näätsaari et al., 2012; Vector Backbone:pPpT4; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:05:25 | 0 | |||
|
HH06-LP Clone 6 heavy chain Resource Report Resource Website |
RRID:Addgene_192176 | Clone 6 heavy chain (HH06) | Synthetic | Bleocin (Zeocin) | PMID:35347138 | Vector Backbone:pFuse; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | NA | 2023-03-31 01:05:32 | 0 | |
|
HH02-LP Clone 2 heavy chain Resource Report Resource Website |
RRID:Addgene_192175 | Clone 2 heavy chain (HH02) | Synthetic | Bleocin (Zeocin) | PMID:35347138 | Vector Backbone:pFuse; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | NA | 2023-03-31 01:05:32 | 0 | |
|
JD553 Resource Report Resource Website |
RRID:Addgene_160392 | wheat GRF4-GIF1 chimera | Other | Bleocin (Zeocin) | PMID:33046875 | Backbone Size:2076; Vector Backbone:pDONR-zeo; Vector Types:Other, Entry clon; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:04:07 | 0 | ||
|
AtZIF1 Resource Report Resource Website |
RRID:Addgene_117885 | AtZIF1 | Arabidopsis thaliana | Bleocin (Zeocin) | PMID: | insert amino acid sequence: MAEEYKEALLEKQNYHDGCPGCKVEQMKQLRRGYPYLELSFVWIIVLSTSLPISSLYPFLYYMIEDFGVAKTEKDIGFYAGFVGCSFMLGRALTSVFWGIVADRYGRKPIILLGTISIAIFNALFGLSSNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAMSAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSQESLFGRFRYALPCFTISAFALLVTVLCCFIPETLHNHKLDSLSHDDSYDILEAASHESSPSTGKAGKNERKASQSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNEVGTVLAISGLGLFSFQVFVYPLAEKLLGPVLVTRYAGALMIPIQMSYPFIAGLSGLSLSLMLNCASILINVLSVSAITGLLILQNRAVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLNAAFLPGSHMVFFVLNVIVVVGVALTFKPFLTTSRR | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:01:17 | 0 | |
|
JD638 Resource Report Resource Website |
RRID:Addgene_160395 | Vitis miR396-resistant GRF4-GIF1 chimera | Other | Bleocin (Zeocin) | PMID:33046875 | Backbone Size:2076; Vector Backbone:pDONR-zeo; Vector Types:Other, Entry clon; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:04:07 | 0 | ||
|
pPICZac-STE2-1D4 Resource Report Resource Website |
RRID:Addgene_133437 | STE2 | Saccharomyces cerevisiae | Bleocin (Zeocin) | PMID: | HMS clone ID number: ScCD00063803. | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | C59S/C252A | 2023-03-31 01:02:16 | 0 |
|
pPICZa-STE2-1D4 Resource Report Resource Website |
RRID:Addgene_133436 | STE2 | Saccharomyces cerevisiae | Bleocin (Zeocin) | PMID: | HMS clone ID number: ScCD00063802. | Vector Backbone:pPICZalpha; Vector Types:Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin) | C59S/C252A | 2023-03-31 01:02:16 | 0 |
|
pPICZaa-STE2-cohis Resource Report Resource Website |
RRID:Addgene_133433 | STE2 | Saccharomyces cerevisiae | Bleocin (Zeocin) | PMID: | HMS clone ID number: ScCD00063799. | Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | C59S/C252A, Codon optimized for P. pastoris, and unique restriction sites added to gene | 2023-03-31 01:02:16 | 0 |
|
p12x601 Resource Report Resource Website |
RRID:Addgene_157785 | pMD2.G(spei/spei)&12x601_tetO | Synthetic | Bleocin (Zeocin) | PMID:31543265 | High copy plasmid (pUC-based, but medium yield) | Backbone Marker:Invitrogen; Vector Backbone:pCR™BluntII-TOPO®; Vector Types:Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:04:06 | 0 | |
|
pPICZ-aC-MSVU-BZ Resource Report Resource Website |
RRID:Addgene_160426 | luciferase | Other | Bleocin (Zeocin) | PMID:33031624 | Please note: Plasmid contains a 39bp deletion that removes the N-terminal amino acids AQDCYEFTLEKRE from the luciferase compared to the depositor's insert sequence. It is not known how this discrepancy affects the plasmid function, though the plasmid was functional in the depositor's experiments. | Backbone Marker:Thermo Fisher; Backbone Size:3600; Vector Backbone:pPICZ-alphaC; Vector Types:Yeast Expression, Luciferase; Bacterial Resistance:Bleocin (Zeocin) | See depositor comments below | 2023-03-31 01:04:07 | 0 |
|
OsSLAC1 Resource Report Resource Website |
RRID:Addgene_117904 | OsSLAC1 | Other | Bleocin (Zeocin) | PMID: | insert amino acid sequence: MAAKPSSSSSSTGGHHTVDIRAAQAQPEDARQSAMSGPINIRGERRPPPMQRAFSRQVSLGSGVTVLGMDKVGKNGGRGQQRALPRSGKSLGVLNHTGALGQAAAGDGAARRGDFSMFRTKSTLSKQNSLLPSRIREPDLELPPHVEGPSVGRQGGEDPLNKSVPAGRYFAALRGPELDEVRDYEDILLPKDEVWPFLLRFPVGCFGVCLGLGSQAILWGALAASPAMRFLHVTPMINVALWLLALAVLVAVSVTYALKCVFYFEAIRREYFHPVRVNFFFAPSIAAMFLTIGLPRAVAPERLHPAVWCAFVAPLFGLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILAARVGWAEAGKFLWAIGVAHYIVVFVTLYQRLPTNEALPKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMALFLYMSLVVRINFFRGFRFSIAWWSYTFPMTTASLATVKYAEAEPCFTSRALALSLSLMSTTMVSLLLVSTLLHAFVWRSLFPNDLAIAITKDRQNGAFKPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKSNSADKEEEEKTECGTENLYFQSGSHHHHHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:01:19 | 0 | |
|
V45 pHIPPY PGL3 Luciferase Resource Report Resource Website |
RRID:Addgene_15099 | PGL3 luciferase siRNA | Bleocin (Zeocin) | PMID:15119963 | Inhibits the expression of PGL3 luciferase. Opposing human H1 and human U6 Pol III promoters drive expression of siRNAs See article and author's map for more information. In the sequence link, the PGL3 luciferase siRNA is lower case. Addgene QC Sanger sequencing did not identify BsmBI sites adjacent to the siRNA sequence. | Backbone Marker:Moon Lab; Backbone Size:2167; Vector Backbone:pHIPPY; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:04:06 | 0 | ||
|
V44 pHIPPY blunt Resource Report Resource Website |
RRID:Addgene_15098 | Bleocin (Zeocin) | PMID:15119963 | This construct is a blunt BsmB1 site version, for use as a NEGATIVE CONTROL for pHippy targetting of siRNAs in mammalian cells. See article and author's map for more information. | Backbone Marker:Moon Lab; Backbone Size:2167; Vector Backbone:pHIPPY; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:04:06 | 0 | |||
|
AtCOPT2 uPIC Resource Report Resource Website |
RRID:Addgene_117900 | AtCOPT2 uPIC | Arabidopsis thaliana | Bleocin (Zeocin) | PMID: | insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:01:18 | 0 | |
|
pGAPZ-STE2-1D4 Resource Report Resource Website |
RRID:Addgene_133423 | STE2 | Saccharomyces cerevisiae | Bleocin (Zeocin) | PMID: | HMS clone ID number: ScCD00063805. | Backbone Size:2900; Vector Backbone:pGAPZ; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | C59S, C252A. No alpha factor secretion signal in vector. | 2023-03-31 01:02:16 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.